Lineage for d2jwda2 (2jwd A:3-59)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309262Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2309263Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2309264Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 protein domains)
    automatically mapped to Pfam PF02216
  6. 2309265Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 2309266Species Staphylococcus aureus [TaxId:1280] [47000] (22 PDB entries)
  8. 2309345Domain d2jwda2: 2jwd A:3-59 [148228]
    Other proteins in same PDB: d2jwda3
    automated match to d1ss1a_

Details for d2jwda2

PDB Entry: 2jwd (more details)

PDB Description: protein A
PDB Compounds: (A:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d2jwda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jwda2 a.8.1.1 (A:3-59) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
dnkfnkeqqnafweilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapk

SCOPe Domain Coordinates for d2jwda2:

Click to download the PDB-style file with coordinates for d2jwda2.
(The format of our PDB-style files is described here.)

Timeline for d2jwda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jwda3