SCOPe 2.07: Domain d2jwda2: 2jwd A:3-59

Lineage for d2jwda2 (2jwd A:3-59)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 protein domains)
   automatically mapped to Pfam PF02216

6. Protein Immunoglobulin-binding protein A modules [46999] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [47000] (22 PDB entries)

8. Domain d2jwda2: 2jwd A:3-59 [148228]
   Other proteins in same PDB: d2jwda3
   automated match to d1ss1a_

Details for d2jwda2

PDB Entry: 2jwd

PDB Description: protein A

PDB Compounds: (A:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d2jwda2:

Sequence; same for both SEQRES and ATOM records:

>d2jwda2 a.8.1.1 (A:3-59) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
dnkfnkeqqnafweilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapk

Timeline for d2jwda2:

• d2jwda2 first appeared in SCOP 1.75, called d2jwda1
  
• d2jwda2 appears in SCOPe 2.06