![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily) dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold ((57888)) dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold ((57888)) |
![]() | Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) ![]() |
![]() | Family g.85.1.1: MYND zinc finger [144233] (3 proteins) Pfam PF01753 |
![]() | Protein Zinc finger MYND domain-containing protein 2, MTG8 [144238] (1 species) Protein CBFA2T1 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144239] (2 PDB entries) Uniprot Q06455 505-551 1499 |
![]() | Domain d2jw6a1: 2jw6 A:503-540 [148225] automatically matched to d2dj8a1 complexed with zn |
PDB Entry: 2jw6 (more details)
SCOP Domain Sequences for d2jw6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jw6a1 g.85.1.1 (A:503-540) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} scvncgreamsectgchkvnycstfcqrkdwkdhqhic
Timeline for d2jw6a1: