Lineage for d2jw6a1 (2jw6 A:503-540)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894619Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold ((57888))
    dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold ((57888))
  4. 894620Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) (S)
  5. 894621Family g.85.1.1: MYND zinc finger [144233] (3 proteins)
    Pfam PF01753
  6. 894629Protein Zinc finger MYND domain-containing protein 2, MTG8 [144238] (1 species)
    Protein CBFA2T1
  7. 894630Species Human (Homo sapiens) [TaxId:9606] [144239] (2 PDB entries)
    Uniprot Q06455 505-551
    1499
  8. 894631Domain d2jw6a1: 2jw6 A:503-540 [148225]
    automatically matched to d2dj8a1
    complexed with zn

Details for d2jw6a1

PDB Entry: 2jw6 (more details)

PDB Description: Solution structure of the DEAF1 MYND domain
PDB Compounds: (A:) Deformed epidermal autoregulatory factor 1 homolog

SCOP Domain Sequences for d2jw6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jw6a1 g.85.1.1 (A:503-540) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]}
scvncgreamsectgchkvnycstfcqrkdwkdhqhic

SCOP Domain Coordinates for d2jw6a1:

Click to download the PDB-style file with coordinates for d2jw6a1.
(The format of our PDB-style files is described here.)

Timeline for d2jw6a1: