Lineage for d2jw6a_ (2jw6 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038778Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888)
  4. 3038779Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) (S)
  5. 3038780Family g.85.1.1: MYND zinc finger [144233] (4 proteins)
    Pfam PF01753
  6. 3038781Protein Deformed epidermal autoregulatory factor 1, DEAF-1 [144234] (1 species)
    Zinc finger MYND domain-containing protein 5
  7. 3038782Species Human (Homo sapiens) [TaxId:9606] [144235] (2 PDB entries)
    Uniprot O75398 503-544
  8. 3038784Domain d2jw6a_: 2jw6 A: [148225]
    automated match to d2dj8a1
    complexed with zn

Details for d2jw6a_

PDB Entry: 2jw6 (more details)

PDB Description: Solution structure of the DEAF1 MYND domain
PDB Compounds: (A:) Deformed epidermal autoregulatory factor 1 homolog

SCOPe Domain Sequences for d2jw6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jw6a_ g.85.1.1 (A:) Deformed epidermal autoregulatory factor 1, DEAF-1 {Human (Homo sapiens) [TaxId: 9606]}
scvncgreamsectgchkvnycstfcqrkdwkdhqhicgqsa

SCOPe Domain Coordinates for d2jw6a_:

Click to download the PDB-style file with coordinates for d2jw6a_.
(The format of our PDB-style files is described here.)

Timeline for d2jw6a_: