Class g: Small proteins [56992] (100 folds) |
Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily) dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888) |
Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) |
Family g.85.1.1: MYND zinc finger [144233] (4 proteins) Pfam PF01753 |
Protein Deformed epidermal autoregulatory factor 1, DEAF-1 [144234] (1 species) Zinc finger MYND domain-containing protein 5 |
Species Human (Homo sapiens) [TaxId:9606] [144235] (2 PDB entries) Uniprot O75398 503-544 |
Domain d2jw6a_: 2jw6 A: [148225] automated match to d2dj8a1 complexed with zn |
PDB Entry: 2jw6 (more details)
SCOPe Domain Sequences for d2jw6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jw6a_ g.85.1.1 (A:) Deformed epidermal autoregulatory factor 1, DEAF-1 {Human (Homo sapiens) [TaxId: 9606]} scvncgreamsectgchkvnycstfcqrkdwkdhqhicgqsa
Timeline for d2jw6a_: