![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.3: Variant SAM domain [158526] (2 proteins) shares a sequence motif with Pfam PF07647, but has a distinct packing of helices |
![]() | Protein Deleted in Liver Cancer 2, DLC2 [158527] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158528] (2 PDB entries) Uniprot Q9Y3M8 50-120 |
![]() | Domain d2jw2a2: 2jw2 A:17-81 [148224] Other proteins in same PDB: d2jw2a3 automated match to d2h80a1 |
PDB Entry: 2jw2 (more details)
SCOPe Domain Sequences for d2jw2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jw2a2 a.60.1.3 (A:17-81) Deleted in Liver Cancer 2, DLC2 {Human (Homo sapiens) [TaxId: 9606]} qeieakeacdwlraagfpqyaqlyedsqfpinivavkndhdflekdlveplcrrlntlnk casmk
Timeline for d2jw2a2: