Lineage for d2jvca1 (2jvc A:6-76)

  1. Root: SCOPe 2.01
  2. 1074148Class k: Designed proteins [58788] (44 folds)
  3. 1074884Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 1074885Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 1074886Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 1074887Protein Ubiquitin [144347] (4 species)
  7. 1074892Species Paramecium tetraurelia strain d4-2 [TaxId:412030] [161334] (1 PDB entry)
  8. 1074893Domain d2jvca1: 2jvc A:6-76 [148222]
    automatically matched to d1yiwa1

Details for d2jvca1

PDB Entry: 2jvc (more details)

PDB Description: nmr solution structure of ubiquitin like protein
PDB Compounds: (A:) ubiquitin_like protein

SCOPe Domain Sequences for d2jvca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jvca1 k.45.1.1 (A:6-76) Ubiquitin {Paramecium tetraurelia strain d4-2 [TaxId: 412030]}
mqifvktltgktitidvdhadtvgavkakiydkegippdqqrlifggkqledsnamsdyn
vqkestlhlvl

SCOPe Domain Coordinates for d2jvca1:

Click to download the PDB-style file with coordinates for d2jvca1.
(The format of our PDB-style files is described here.)

Timeline for d2jvca1: