Class a: All alpha proteins [46456] (286 folds) |
Fold a.284: YejL-like [158650] (1 superfamily) 6 helices; intertwined homodimer of three-helical subunits, bundle |
Superfamily a.284.1: YejL-like [158651] (1 family) |
Family a.284.1.1: YejL-like [158652] (5 proteins) Pfam PF07208; DUF1414 |
Protein Uncharacterized protein HI0840 [158655] (1 species) |
Species Haemophilus influenzae [TaxId:727] [158656] (1 PDB entry) Uniprot P44897 1-72 |
Domain d2juzb_: 2juz B: [148220] automated match to d2juza1 |
PDB Entry: 2juz (more details)
SCOPe Domain Sequences for d2juzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2juzb_ a.284.1.1 (B:) Uncharacterized protein HI0840 {Haemophilus influenzae [TaxId: 727]} maqhskysdaqlsaivndmiavlekhkapvdlslialgnmasnllttsvpqtqcealaqa fsnslinavktrlehhhhhh
Timeline for d2juzb_: