Lineage for d2juzb_ (2juz B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1755221Fold a.284: YejL-like [158650] (1 superfamily)
    6 helices; intertwined homodimer of three-helical subunits, bundle
  4. 1755222Superfamily a.284.1: YejL-like [158651] (1 family) (S)
  5. 1755223Family a.284.1.1: YejL-like [158652] (5 proteins)
    Pfam PF07208; DUF1414
  6. 1755234Protein Uncharacterized protein HI0840 [158655] (1 species)
  7. 1755235Species Haemophilus influenzae [TaxId:727] [158656] (1 PDB entry)
    Uniprot P44897 1-72
  8. 1755237Domain d2juzb_: 2juz B: [148220]
    automated match to d2juza1

Details for d2juzb_

PDB Entry: 2juz (more details)

PDB Description: Solution NMR structure of HI0947 from Haemophilus influenzae, Northeast Structural Genomics Consortium Target IR123
PDB Compounds: (B:) UPF0352 protein HI0840

SCOPe Domain Sequences for d2juzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2juzb_ a.284.1.1 (B:) Uncharacterized protein HI0840 {Haemophilus influenzae [TaxId: 727]}
maqhskysdaqlsaivndmiavlekhkapvdlslialgnmasnllttsvpqtqcealaqa
fsnslinavktrlehhhhhh

SCOPe Domain Coordinates for d2juzb_:

Click to download the PDB-style file with coordinates for d2juzb_.
(The format of our PDB-style files is described here.)

Timeline for d2juzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2juza1