![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.284: YejL-like [158650] (1 superfamily) 6 helices; intertwined homodimer of three-helical subunits, bundle |
![]() | Superfamily a.284.1: YejL-like [158651] (1 family) ![]() |
![]() | Family a.284.1.1: YejL-like [158652] (5 proteins) Pfam PF07208; DUF1414 |
![]() | Protein Uncharacterized protein HI0840 [158655] (1 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [158656] (1 PDB entry) Uniprot P44897 1-72 |
![]() | Domain d2juza1: 2juz A:1-72 [148219] Other proteins in same PDB: d2juza2, d2juzb3 |
PDB Entry: 2juz (more details)
SCOPe Domain Sequences for d2juza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2juza1 a.284.1.1 (A:1-72) Uncharacterized protein HI0840 {Haemophilus influenzae [TaxId: 727]} maqhskysdaqlsaivndmiavlekhkapvdlslialgnmasnllttsvpqtqcealaqa fsnslinavktr
Timeline for d2juza1: