Lineage for d2juwa1 (2juw A:1-72)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2352103Fold a.284: YejL-like [158650] (1 superfamily)
    6 helices; intertwined homodimer of three-helical subunits, bundle
  4. 2352104Superfamily a.284.1: YejL-like [158651] (1 family) (S)
  5. 2352105Family a.284.1.1: YejL-like [158652] (5 proteins)
    Pfam PF07208; DUF1414
  6. 2352120Protein Uncharacterized protein SO2176 [158661] (1 species)
  7. 2352121Species Shewanella oneidensis [TaxId:70863] [158662] (2 PDB entries)
    Uniprot Q8EF26 1-72
  8. 2352123Domain d2juwa1: 2juw A:1-72 [148217]
    Other proteins in same PDB: d2juwa2, d2juwb3

Details for d2juwa1

PDB Entry: 2juw (more details)

PDB Description: nmr solution structure of homodimer protein so_2176 from shewanella oneidensis. northeast structural genomics consortium target sor77
PDB Compounds: (A:) UPF0352 protein SO_2176

SCOPe Domain Sequences for d2juwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2juwa1 a.284.1.1 (A:1-72) Uncharacterized protein SO2176 {Shewanella oneidensis [TaxId: 70863]}
maiqskysntqvesliaeilvvlekhkaptdlslmalgncvthllerkvpsesrqavaeq
fakalaqsvksn

SCOPe Domain Coordinates for d2juwa1:

Click to download the PDB-style file with coordinates for d2juwa1.
(The format of our PDB-style files is described here.)

Timeline for d2juwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2juwa2