Lineage for d2juaa1 (2jua A:1-102)
- Root: SCOP 1.75
Class k: Designed proteins [58788] (44 folds) 
Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily) Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) 
Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
this is not a true family
Protein De novo designed protein s-824 [103787] (2 species)
single-chain four-helical protein
Species unidentified [TaxId:32644] [161314] (1 PDB entry) 
Domain d2juaa1: 2jua A:1-102 [148212]
automatically matched to d1p68a_
Details for d2juaa1
PDB Entry: 2jua (more details)
PDB Description: assignment, structure, and dynamics of de novo designed protein s836
PDB Compounds: (A:) de novo protein S836SCOP Domain Sequences for d2juaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2juaa1 k.8.1.1 (A:1-102) De novo designed protein s-824 {unidentified [TaxId: 32644]}
mygklndlledlqevlkhvnqhwqggqknmnkvdhhlqnviedihdfmqgggsggklqem
mkefqqvldeikqqlqggdnslhnvhenikeifhhleelvhr
SCOP Domain Coordinates for d2juaa1:
Click to download the PDB-style file with coordinates for d2juaa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2juaa1:
- d2juaa1 is new in SCOP 1.75
- d2juaa1 appears in SCOPe 2.01
- d2juaa1 appears in the current release, SCOPe 2.08
View in 3D