Lineage for d2juaa1 (2jua A:1-102)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3047948Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily)
  4. 3047949Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) (S)
  5. 3047950Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
    this is not a true family
  6. 3047997Protein De novo designed protein s-824 [103787] (2 species)
    single-chain four-helical protein
  7. 3048000Species unidentified [TaxId:32644] [161314] (1 PDB entry)
  8. 3048001Domain d2juaa1: 2jua A:1-102 [148212]
    automatically matched to d1p68a_

Details for d2juaa1

PDB Entry: 2jua (more details)

PDB Description: assignment, structure, and dynamics of de novo designed protein s836
PDB Compounds: (A:) de novo protein S836

SCOPe Domain Sequences for d2juaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2juaa1 k.8.1.1 (A:1-102) De novo designed protein s-824 {unidentified [TaxId: 32644]}
mygklndlledlqevlkhvnqhwqggqknmnkvdhhlqnviedihdfmqgggsggklqem
mkefqqvldeikqqlqggdnslhnvhenikeifhhleelvhr

SCOPe Domain Coordinates for d2juaa1:

Click to download the PDB-style file with coordinates for d2juaa1.
(The format of our PDB-style files is described here.)

Timeline for d2juaa1: