SCOP 1.75: Domain d2ju3a1: 2ju3 A:1-127

Lineage for d2ju3a1 (2ju3 A:1-127)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Liver fatty acid binding protein [50866] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50867] (4 PDB entries)

8. Domain d2ju3a1: 2ju3 A:1-127 [148209]
   automatically matched to d1lfoa_

Details for d2ju3a1

PDB Entry: 2ju3

PDB Description: solution-state nmr structures of apo-lfabp (liver fatty acid-binding protein)

PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOP Domain Sequences for d2ju3a1:

Sequence; same for both SEQRES and ATOM records:

>d2ju3a1 b.60.1.2 (A:1-127) Liver fatty acid binding protein {Rat (Rattus norvegicus) [TaxId: 10116]}
mnfsgkyqvqsqenfepfmkamglpedliqkgkdikgvseivhegkkvkltitygskvih
neftlgeeceletmtgekvkavvkmegdnkmvttfkgiksvtefngdtitntmtlgdivy
krvskri

Timeline for d2ju3a1:

• d2ju3a1 is new in SCOP 1.75
  
• d2ju3a1 appears in SCOPe 2.01
  
• d2ju3a1 appears in the current release, SCOPe 2.08, called d2ju3a_