Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Troponin C [47503] (6 species) |
Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries) |
Domain d2jtza_: 2jtz A: [148207] automated match to d1br1b_ mutant |
PDB Entry: 2jtz (more details)
SCOPe Domain Sequences for d2jtza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jtza_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmwdknadgyidldelkim lqatgetiteddieelmkdgdknndgridydeflefmkgve
Timeline for d2jtza_: