Lineage for d2jt6a1 (2jt6 A:88-248)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423492Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1423493Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1423977Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1424220Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 1424221Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (40 PDB entries)
  8. 1424281Domain d2jt6a1: 2jt6 A:88-248 [148200]
    automatically matched to d1b3db_
    complexed with ca, jt6, zn

Details for d2jt6a1

PDB Entry: 2jt6 (more details)

PDB Description: solution structure of matrix metalloproteinase 3 (mmp-3) in the presence of 3-4'-cyanobyphenyl-4-yloxy)-n-hdydroxypropionamide (mmp-3 inhibitor vii)
PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d2jt6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jt6a1 d.92.1.11 (A:88-248) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
gipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfa
vrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighsl
glfhsantealmyplyhsltdltrfrlsqddingiqslygp

SCOPe Domain Coordinates for d2jt6a1:

Click to download the PDB-style file with coordinates for d2jt6a1.
(The format of our PDB-style files is described here.)

Timeline for d2jt6a1: