Lineage for d2jt5a1 (2jt5 A:88-248)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 867875Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 868041Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 868042Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (35 PDB entries)
  8. 868098Domain d2jt5a1: 2jt5 A:88-248 [148199]
    automatically matched to d1b3db_
    complexed with ca, jt5, zn

Details for d2jt5a1

PDB Entry: 2jt5 (more details)

PDB Description: solution structure of matrix metalloproteinase 3 (mmp-3) in the presence of n-hydroxy-2-[n-(2-hydroxyethyl)biphenyl-4-sulfonamide] hydroxamic acid (mlc88)
PDB Compounds: (A:) stromelysin-1

SCOP Domain Sequences for d2jt5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jt5a1 d.92.1.11 (A:88-248) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
gipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfa
vrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighsl
glfhsantealmyplyhsltdltrfrlsqddingiqslygp

SCOP Domain Coordinates for d2jt5a1:

Click to download the PDB-style file with coordinates for d2jt5a1.
(The format of our PDB-style files is described here.)

Timeline for d2jt5a1: