Lineage for d2jsfa_ (2jsf A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771144Species Dengue virus [TaxId:11060] [255294] (1 PDB entry)
  8. 1771145Domain d2jsfa_: 2jsf A: [148191]
    automated match to d1s6na_

Details for d2jsfa_

PDB Entry: 2jsf (more details)

PDB Description: Solution structures of the envelope protein domain III from the dengue-2 virus
PDB Compounds: (A:) domain III of ENVELOPE PROTEIN E

SCOPe Domain Sequences for d2jsfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jsfa_ b.1.18.0 (A:) automated matches {Dengue virus [TaxId: 11060]}
mdklqlkgmsysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvl
grlitvnpivtekdspvnieaeppfgdsyiiigvepgqlklnwfkkgsslehhhhhh

SCOPe Domain Coordinates for d2jsfa_:

Click to download the PDB-style file with coordinates for d2jsfa_.
(The format of our PDB-style files is described here.)

Timeline for d2jsfa_: