SCOPe 2.08: Domain d2jsfa2: 2jsf A:1-109

Lineage for d2jsfa2 (2jsf A:1-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Dengue virus [TaxId:11060] [255294] (1 PDB entry)

8. Domain d2jsfa2: 2jsf A:1-109 [148191]
   Other proteins in same PDB: d2jsfa3
   automated match to d1s6na_

Details for d2jsfa2

PDB Entry: 2jsf

PDB Description: Solution structures of the envelope protein domain III from the dengue-2 virus

PDB Compounds: (A:) domain III of ENVELOPE PROTEIN E

SCOPe Domain Sequences for d2jsfa2:

Sequence; same for both SEQRES and ATOM records:

>d2jsfa2 b.1.18.0 (A:1-109) automated matches {Dengue virus [TaxId: 11060]}
mdklqlkgmsysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvl
grlitvnpivtekdspvnieaeppfgdsyiiigvepgqlklnwfkkgss

Timeline for d2jsfa2:

• d2jsfa2 first appeared in SCOP 1.75, called d2jsfa1
  
• d2jsfa2 appears in SCOPe 2.07