Lineage for d2jsfa2 (2jsf A:1-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766243Species Dengue virus [TaxId:11060] [255294] (1 PDB entry)
  8. 2766244Domain d2jsfa2: 2jsf A:1-109 [148191]
    Other proteins in same PDB: d2jsfa3
    automated match to d1s6na_

Details for d2jsfa2

PDB Entry: 2jsf (more details)

PDB Description: Solution structures of the envelope protein domain III from the dengue-2 virus
PDB Compounds: (A:) domain III of ENVELOPE PROTEIN E

SCOPe Domain Sequences for d2jsfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jsfa2 b.1.18.0 (A:1-109) automated matches {Dengue virus [TaxId: 11060]}
mdklqlkgmsysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvl
grlitvnpivtekdspvnieaeppfgdsyiiigvepgqlklnwfkkgss

SCOPe Domain Coordinates for d2jsfa2:

Click to download the PDB-style file with coordinates for d2jsfa2.
(The format of our PDB-style files is described here.)

Timeline for d2jsfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jsfa3