| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.7: YvfG-like [158388] (1 family) ![]() automatically mapped to Pfam PF09628 |
| Family a.23.7.1: YvfG-like [158389] (1 protein) Pfam PF09628 |
| Protein Hypothetical protein YvfG [158390] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [158391] (2 PDB entries) Uniprot P71066 3-69 |
| Domain d2js1b2: 2js1 B:1-72 [148190] Other proteins in same PDB: d2js1a3, d2js1b3 automated match to d2gsvb_ |
PDB Entry: 2js1 (more details)
SCOPe Domain Sequences for d2js1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2js1b2 a.23.7.1 (B:1-72) Hypothetical protein YvfG {Bacillus subtilis [TaxId: 1423]}
mselfsvpyfienlkqhiemnqsedkihamnsyyrsvvstlvqdqltknavvlkriqhld
eaynkvkrgesk
Timeline for d2js1b2: