SCOPe 2.08: Domain d2js1a2: 2js1 A:1-72

Lineage for d2js1a2 (2js1 A:1-72)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.7: YvfG-like [158388] (1 family)
   automatically mapped to Pfam PF09628

5. Family a.23.7.1: YvfG-like [158389] (1 protein)
   Pfam PF09628

6. Protein Hypothetical protein YvfG [158390] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [158391] (2 PDB entries)
   Uniprot P71066 3-69

8. Domain d2js1a2: 2js1 A:1-72 [148189]
   Other proteins in same PDB: d2js1a3, d2js1b3
   automated match to d2gsvb_

Details for d2js1a2

PDB Entry: 2js1

PDB Description: solution nmr structure of the homodimer protein yvfg from bacillus subtilis, northeast structural genomics consortium target sr478

PDB Compounds: (A:) Uncharacterized protein yvfG

SCOPe Domain Sequences for d2js1a2:

Sequence; same for both SEQRES and ATOM records:

>d2js1a2 a.23.7.1 (A:1-72) Hypothetical protein YvfG {Bacillus subtilis [TaxId: 1423]}
mselfsvpyfienlkqhiemnqsedkihamnsyyrsvvstlvqdqltknavvlkriqhld
eaynkvkrgesk

Timeline for d2js1a2:

• d2js1a2 first appeared in SCOP 1.75, called d2js1a1
  
• d2js1a2 appears in SCOPe 2.07