SCOPe 2.08: Domain d2jrxa1: 2jrx A:1-75

Lineage for d2jrxa1 (2jrx A:1-75)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.284: YejL-like [158650] (1 superfamily)
   6 helices; intertwined homodimer of three-helical subunits, bundle

4. Superfamily a.284.1: YejL-like [158651] (1 family)

5. Family a.284.1.1: YejL-like [158652] (5 proteins)
   Pfam PF07208; DUF1414

6. Protein Uncharacterized protein YejL [158659] (1 species)

7. Species Escherichia coli [TaxId:562] [158660] (1 PDB entry)
   Uniprot P0AD24 1-75

8. Domain d2jrxa1: 2jrx A:1-75 [148187]
   Other proteins in same PDB: d2jrxa2, d2jrxb3

Details for d2jrxa1

PDB Entry: 2jrx

PDB Description: solution nmr structure of protein yejl from e. coli. northeast structural genomics target er309

PDB Compounds: (A:) UPF0352 protein yejL

SCOPe Domain Sequences for d2jrxa1:

Sequence; same for both SEQRES and ATOM records:

>d2jrxa1 a.284.1.1 (A:1-75) Uncharacterized protein YejL {Escherichia coli [TaxId: 562]}
mpqisrysdeqveqllaellnvlekhkaptdlslmvlgnmvtnlintsiapaqrqaians
faralqssinedkah

Timeline for d2jrxa1:

• d2jrxa1 first appeared in SCOP 1.75
  
• d2jrxa1 appears in SCOPe 2.07