SCOPe 2.05: Domain d2jr2b_: 2jr2 B:

Lineage for d2jr2b_ (2jr2 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.284: YejL-like [158650] (1 superfamily)
   6 helices; intertwined homodimer of three-helical subunits, bundle

4. Superfamily a.284.1: YejL-like [158651] (1 family)

5. Family a.284.1.1: YejL-like [158652] (5 proteins)
   Pfam PF07208; DUF1414

6. Protein Hypothetical protein CPS2611 [158653] (1 species)

7. Species Colwellia psychrerythraea [TaxId:28229] [158654] (2 PDB entries)
   Uniprot Q481E4 7-68

8. Domain d2jr2b_: 2jr2 B: [148183]
   automated match to d2jrxa1

Details for d2jr2b_

PDB Entry: 2jr2

PDB Description: solution nmr structure of homodimer cps_2611 from colwellia psychrerythraea. northeast structural genomics consortium target csr4.

PDB Compounds: (B:) UPF0352 protein CPS_2611

SCOPe Domain Sequences for d2jr2b_:

Sequence; same for both SEQRES and ATOM records:

>d2jr2b_ a.284.1.1 (B:) Hypothetical protein CPS2611 {Colwellia psychrerythraea [TaxId: 28229]}
mpivskysnervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnf
tkalkqsvlehhhhhh

Timeline for d2jr2b_:

• d2jr2b_ first appeared in SCOP 1.75, called d2jr2b1
  
• d2jr2b_ appears in SCOPe 2.04
  
• d2jr2b_ is called d2jr2b2 in SCOPe 2.06
  
• d2jr2b_ appears in the current release, SCOPe 2.08, called d2jr2b2