Lineage for d2jr2a1 (2jr2 A:7-68)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.284: YejL-like [158650] (1 superfamily)
6 helices; intertwined homodimer of three-helical subunits, bundleSuperfamily a.284.1: YejL-like [158651] (1 family) 
Family a.284.1.1: YejL-like [158652] (5 proteins)
Pfam PF07208; DUF1414Protein Hypothetical protein CPS2611 [158653] (1 species) Species Colwellia psychrerythraea [TaxId:28229] [158654] (2 PDB entries)
Uniprot Q481E4 7-68
Domain d2jr2a1: 2jr2 A:7-68 [148182]
automatically matched to 2OTA A:7-68
Details for d2jr2a1
PDB Entry: 2jr2 (more details)
PDB Description: solution nmr structure of homodimer cps_2611 from colwellia psychrerythraea. northeast structural genomics consortium target csr4.
PDB Compounds: (A:) UPF0352 protein CPS_2611SCOPe Domain Sequences for d2jr2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jr2a1 a.284.1.1 (A:7-68) Hypothetical protein CPS2611 {Colwellia psychrerythraea [TaxId: 28229]}
ysnervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnftkalkq
sv
SCOPe Domain Coordinates for d2jr2a1:
Click to download the PDB-style file with coordinates for d2jr2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2jr2a1:
- d2jr2a1 first appeared in SCOP 1.75
- d2jr2a1 appears in SCOPe 2.02
- d2jr2a1 is called d2jr2a_ in SCOPe 2.04
- d2jr2a1 appears in the current release, SCOPe 2.08, called d2jr2a2
View in 3D
