Lineage for d2jqha_ (2jqh A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724737Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 1724738Family a.7.14.1: MIT domain [116847] (4 proteins)
    Pfam PF04212
    this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain
  6. 1724745Protein Vacuolar sorting protein 4b (VPS4B, SKD1 protein) [140354] (1 species)
  7. 1724746Species Human (Homo sapiens) [TaxId:9606] [140355] (4 PDB entries)
    Uniprot O75351 1-104! Uniprot O75351 1-77
  8. 1724747Domain d2jqha_: 2jqh A: [148177]
    automated match to d1wr0a1

Details for d2jqha_

PDB Entry: 2jqh (more details)

PDB Description: vps4b mit
PDB Compounds: (A:) Vacuolar protein sorting-associating protein 4B

SCOPe Domain Sequences for d2jqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jqha_ a.7.14.1 (A:) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]}
nlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsirakcteyl
draeklkeylkn

SCOPe Domain Coordinates for d2jqha_:

Click to download the PDB-style file with coordinates for d2jqha_.
(The format of our PDB-style files is described here.)

Timeline for d2jqha_: