Class a: All alpha proteins [46456] (285 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.14: MIT domain [116846] (2 families) |
Family a.7.14.1: MIT domain [116847] (3 proteins) Pfam PF04212 this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain |
Protein Vacuolar sorting protein 4b (VPS4B, SKD1 protein) [140354] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140355] (4 PDB entries) Uniprot O75351 1-104! Uniprot O75351 1-77 |
Domain d2jqha_: 2jqh A: [148177] automated match to d1wr0a1 |
PDB Entry: 2jqh (more details)
SCOPe Domain Sequences for d2jqha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jqha_ a.7.14.1 (A:) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} nlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsirakcteyl draeklkeylkn
Timeline for d2jqha_: