SCOPe 2.07: Domain d2jqgr_: 2jqg R:

Lineage for d2jqgr_ (2jqg R:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.2: FMDV leader protease [54037] (2 proteins)
   automatically mapped to Pfam PF05408

6. Protein automated matches [254558] (3 species)
   not a true protein

7. Species Foot-and-mouth disease virus (strain o1) [TaxId:73482] [255285] (1 PDB entry)

8. Domain d2jqgr_: 2jqg R: [148176]
   automated match to d1qola_

Details for d2jqgr_

PDB Entry: 2jqg

PDB Description: leader protease

PDB Compounds: (R:) Genome polyprotein

SCOPe Domain Sequences for d2jqgr_:

Sequence; same for both SEQRES and ATOM records:

>d2jqgr_ d.3.1.2 (R:) automated matches {Foot-and-mouth disease virus (strain o1) [TaxId: 73482]}
meltlyngekktfysrpnnhdnawlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqeplngewkak

Timeline for d2jqgr_:

• d2jqgr_ first appeared in SCOP 1.75, called d2jqgr1
  
• d2jqgr_ appears in SCOPe 2.06
  
• d2jqgr_ appears in the current release, SCOPe 2.08