SCOP 1.75: Domain d2jqfs1: 2jqf S:229-401

Lineage for d2jqfs1 (2jqf S:229-401)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.2: FMDV leader protease [54037] (1 protein)

6. Protein FMDV leader protease [54038] (1 species)

7. Species Foot-and-mouth disease virus [TaxId:12110] [54039] (4 PDB entries)

8. Domain d2jqfs1: 2jqf S:229-401 [148175]
   automatically matched to d1qola_
   mutant

Details for d2jqfs1

PDB Entry: 2jqf

PDB Description: full length leader protease of foot and mouth disease virus c51a mutant

PDB Compounds: (S:) Genome polyprotein

SCOP Domain Sequences for d2jqfs1:

Sequence; same for both SEQRES and ATOM records:

>d2jqfs1 d.3.1.2 (S:229-401) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]}
meltlyngekktfysrpnnhdnawlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqeplngewkakvqrklk

Timeline for d2jqfs1:

• d2jqfs1 is new in SCOP 1.75
  
• d2jqfs1 appears in SCOPe 2.01
  
• d2jqfs1 appears in the current release, SCOPe 2.08, called d2jqfs_