Lineage for d2jq9a1 (2jq9 A:5-75)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 908235Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 908555Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 908556Family a.7.14.1: MIT domain [116847] (3 proteins)
    Pfam PF04212
    this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain
  6. 908560Protein Vacuolar protein sorting factor 4a (VPS4A, SKD2) [140352] (1 species)
  7. 908561Species Human (Homo sapiens) [TaxId:9606] [140353] (2 PDB entries)
    Uniprot Q9UN37 1-77
  8. 908563Domain d2jq9a1: 2jq9 A:5-75 [148173]
    automatically matched to d1yxra1

Details for d2jq9a1

PDB Entry: 2jq9 (more details)

PDB Description: vps4a mit-chmp1a complex
PDB Compounds: (A:) Vacuolar protein sorting-associating protein 4A

SCOPe Domain Sequences for d2jq9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jq9a1 a.7.14.1 (A:5-75) Vacuolar protein sorting factor 4a (VPS4A, SKD2) {Human (Homo sapiens) [TaxId: 9606]}
tlqkaidlvtkateedkaknyeealrlyqhaveyflhaikyeahsdkakesirakcvqyl
draeklkdylr

SCOPe Domain Coordinates for d2jq9a1:

Click to download the PDB-style file with coordinates for d2jq9a1.
(The format of our PDB-style files is described here.)

Timeline for d2jq9a1: