SCOPe 2.05: Domain d2jq7a1: 2jq7 A:8-140

Lineage for d2jq7a1 (2jq7 A:8-140)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [161274] (2 PDB entries)

8. Domain d2jq7a1: 2jq7 A:8-140 [148171]
   automatically matched to d1eg0k_
   protein/RNA complex

Details for d2jq7a1

PDB Entry: 2jq7

PDB Description: model for thiostrepton binding to the ribosomal l11-rna

PDB Compounds: (A:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2jq7a1:

Sequence; same for both SEQRES and ATOM records:

>d2jq7a1 i.1.1.1 (A:8-140) 70S ribosome functional complex {Thermotoga maritima [TaxId: 2336]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

Timeline for d2jq7a1:

• d2jq7a1 first appeared in SCOP 1.75
  
• d2jq7a1 appears in SCOPe 2.04
  
• d2jq7a1 appears in SCOPe 2.06
  
• d2jq7a1 appears in the current release, SCOPe 2.08