| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
| Protein 70S ribosome functional complex [58121] (4 species) |
| Species Thermotoga maritima [TaxId:2336] [161274] (2 PDB entries) |
| Domain d2jq7a1: 2jq7 A:8-140 [148171] automatically matched to d1eg0k_ protein/RNA complex |
PDB Entry: 2jq7 (more details)
SCOPe Domain Sequences for d2jq7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jq7a1 i.1.1.1 (A:8-140) 70S ribosome functional complex {Thermotoga maritima [TaxId: 2336]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv
Timeline for d2jq7a1: