Lineage for d2jq7a1 (2jq7 A:8-140)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2592941Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2592942Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2592943Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2592944Protein 70S ribosome functional complex [58121] (4 species)
  7. 2593498Species Thermotoga maritima [TaxId:2336] [161274] (2 PDB entries)
  8. 2593500Domain d2jq7a1: 2jq7 A:8-140 [148171]
    automatically matched to d1eg0k_
    protein/RNA complex

Details for d2jq7a1

PDB Entry: 2jq7 (more details)

PDB Description: model for thiostrepton binding to the ribosomal l11-rna
PDB Compounds: (A:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2jq7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jq7a1 i.1.1.1 (A:8-140) 70S ribosome functional complex {Thermotoga maritima [TaxId: 2336]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

SCOPe Domain Coordinates for d2jq7a1:

Click to download the PDB-style file with coordinates for d2jq7a1.
(The format of our PDB-style files is described here.)

Timeline for d2jq7a1: