SCOPe 2.08: Domain d2jpra_: 2jpr A:

Lineage for d2jpra_ (2jpr A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d2jpra_: 2jpr A: [148169]
   automated match to d1afva_
   complexed with jpr

Details for d2jpra_

PDB Entry: 2jpr

PDB Description: joint refinement of the hiv-1 ca-ntd in complex with the assembly inhibitor cap-1

PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d2jpra_:

Sequence; same for both SEQRES and ATOM records:

>d2jpra_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

Timeline for d2jpra_:

• d2jpra_ first appeared in SCOP 1.75, called d2jpra1
  
• d2jpra_ appears in SCOPe 2.07