SCOPe 2.06: Domain d2jpqb2: 2jpq B:1-77

Lineage for d2jpqb2 (2jpq B:1-77)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.284: YejL-like [158650] (1 superfamily)
   6 helices; intertwined homodimer of three-helical subunits, bundle

4. Superfamily a.284.1: YejL-like [158651] (1 family)

5. Family a.284.1.1: YejL-like [158652] (5 proteins)
   Pfam PF07208; DUF1414

6. Protein Hypothetical protein VP2129 [158657] (1 species)

7. Species Vibrio parahaemolyticus [TaxId:670] [158658] (1 PDB entry)
   Uniprot Q87MV2 1-75

8. Domain d2jpqb2: 2jpq B:1-77 [148168]
   Other proteins in same PDB: d2jpqa2, d2jpqb3
   automated match to d2jpqa1

Details for d2jpqb2

PDB Entry: 2jpq

PDB Description: solution nmr structure of homodimer vp2129 from vibrio parahaemolyticus. northeast structural genomics consortium target vpr61.

PDB Compounds: (B:) UPF0352 protein VP2129

SCOPe Domain Sequences for d2jpqb2:

Sequence; same for both SEQRES and ATOM records:

>d2jpqb2 a.284.1.1 (B:1-77) Hypothetical protein VP2129 {Vibrio parahaemolyticus [TaxId: 670]}
mpitskytdeqvekilaevalvlekhaaspeltlmiagniatnvlnqrvaasqrkliaek
faqalmssletpkthle

Timeline for d2jpqb2:

• d2jpqb2 first appeared in SCOP 1.75, called d2jpqb1
  
• d2jpqb2 was called d2jpqb_ in SCOPe 2.05
  
• d2jpqb2 appears in SCOPe 2.07
  
• d2jpqb2 appears in the current release, SCOPe 2.08