Lineage for d2jpqb1 (2jpq B:1-75)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781392Fold a.284: YejL-like [158650] (1 superfamily)
    6 helices; intertwined homodimer of three-helical subunits, bundle
  4. 781393Superfamily a.284.1: YejL-like [158651] (1 family) (S)
  5. 781394Family a.284.1.1: YejL-like [158652] (5 proteins)
    Pfam PF07208; DUF1414
  6. 781401Protein Hypothetical protein VP2129 [158657] (1 species)
  7. 781402Species Vibrio parahaemolyticus [TaxId:670] [158658] (1 PDB entry)
    Uniprot Q87MV2 1-75
  8. 781404Domain d2jpqb1: 2jpq B:1-75 [148168]
    automatically matched to 2JPQ A:1-75

Details for d2jpqb1

PDB Entry: 2jpq (more details)

PDB Description: solution nmr structure of homodimer vp2129 from vibrio parahaemolyticus. northeast structural genomics consortium target vpr61.
PDB Compounds: (B:) UPF0352 protein VP2129

SCOP Domain Sequences for d2jpqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jpqb1 a.284.1.1 (B:1-75) Hypothetical protein VP2129 {Vibrio parahaemolyticus [TaxId: 670]}
mpitskytdeqvekilaevalvlekhaaspeltlmiagniatnvlnqrvaasqrkliaek
faqalmssletpkth

SCOP Domain Coordinates for d2jpqb1:

Click to download the PDB-style file with coordinates for d2jpqb1.
(The format of our PDB-style files is described here.)

Timeline for d2jpqb1: