![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.284: YejL-like [158650] (1 superfamily) 6 helices; intertwined homodimer of three-helical subunits, bundle |
![]() | Superfamily a.284.1: YejL-like [158651] (1 family) ![]() |
![]() | Family a.284.1.1: YejL-like [158652] (5 proteins) Pfam PF07208; DUF1414 |
![]() | Protein Hypothetical protein VP2129 [158657] (1 species) |
![]() | Species Vibrio parahaemolyticus [TaxId:670] [158658] (1 PDB entry) Uniprot Q87MV2 1-75 |
![]() | Domain d2jpqb2: 2jpq B:1-77 [148168] Other proteins in same PDB: d2jpqa2, d2jpqb3 automated match to d2jpqa1 |
PDB Entry: 2jpq (more details)
SCOPe Domain Sequences for d2jpqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jpqb2 a.284.1.1 (B:1-77) Hypothetical protein VP2129 {Vibrio parahaemolyticus [TaxId: 670]} mpitskytdeqvekilaevalvlekhaaspeltlmiagniatnvlnqrvaasqrkliaek faqalmssletpkthle
Timeline for d2jpqb2: