SCOPe 2.06: Domain d2jpqa1: 2jpq A:1-75

Lineage for d2jpqa1 (2jpq A:1-75)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.284: YejL-like [158650] (1 superfamily)
   6 helices; intertwined homodimer of three-helical subunits, bundle

4. Superfamily a.284.1: YejL-like [158651] (1 family)

5. Family a.284.1.1: YejL-like [158652] (5 proteins)
   Pfam PF07208; DUF1414

6. Protein Hypothetical protein VP2129 [158657] (1 species)

7. Species Vibrio parahaemolyticus [TaxId:670] [158658] (1 PDB entry)
   Uniprot Q87MV2 1-75

8. Domain d2jpqa1: 2jpq A:1-75 [148167]
   Other proteins in same PDB: d2jpqa2, d2jpqb3

Details for d2jpqa1

PDB Entry: 2jpq

PDB Description: solution nmr structure of homodimer vp2129 from vibrio parahaemolyticus. northeast structural genomics consortium target vpr61.

PDB Compounds: (A:) UPF0352 protein VP2129

SCOPe Domain Sequences for d2jpqa1:

Sequence; same for both SEQRES and ATOM records:

>d2jpqa1 a.284.1.1 (A:1-75) Hypothetical protein VP2129 {Vibrio parahaemolyticus [TaxId: 670]}
mpitskytdeqvekilaevalvlekhaaspeltlmiagniatnvlnqrvaasqrkliaek
faqalmssletpkth

Timeline for d2jpqa1:

• d2jpqa1 first appeared in SCOP 1.75
  
• d2jpqa1 appears in SCOPe 2.05
  
• d2jpqa1 appears in SCOPe 2.07
  
• d2jpqa1 appears in the current release, SCOPe 2.08