Lineage for d2jpoa1 (2jpo A:1-142)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1269819Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 1269820Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 1269821Protein Moth pheromone-binding protein, PBP [47569] (2 species)
  7. 1269822Species Polyphemus moth (Antheraea polyphemus) [TaxId:7120] [101187] (3 PDB entries)
  8. 1269823Domain d2jpoa1: 2jpo A:1-142 [148166]
    automatically matched to d1qwva_

Details for d2jpoa1

PDB Entry: 2jpo (more details)

PDB Description: NMR structure of Antheraea polyphemus pheromone-binding protein 1 at pH 4.5
PDB Compounds: (A:) pheromone-binding protein

SCOPe Domain Sequences for d2jpoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jpoa1 a.39.2.1 (A:1-142) Moth pheromone-binding protein, PBP {Polyphemus moth (Antheraea polyphemus) [TaxId: 7120]}
speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld
vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk
eihklnwvpnmdlvigevlaev

SCOPe Domain Coordinates for d2jpoa1:

Click to download the PDB-style file with coordinates for d2jpoa1.
(The format of our PDB-style files is described here.)

Timeline for d2jpoa1: