SCOP 1.75: Domain d2jpoa1: 2jpo A:1-142

Lineage for d2jpoa1 (2jpo A:1-142)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)

6. Protein Moth pheromone-binding protein, PBP [47569] (2 species)

7. Species Polyphemus moth (Antheraea polyphemus) [TaxId:7120] [101187] (3 PDB entries)

8. Domain d2jpoa1: 2jpo A:1-142 [148166]
   automatically matched to d1qwva_

Details for d2jpoa1

PDB Entry: 2jpo

PDB Description: NMR structure of Antheraea polyphemus pheromone-binding protein 1 at pH 4.5

PDB Compounds: (A:) pheromone-binding protein

SCOP Domain Sequences for d2jpoa1:

Sequence; same for both SEQRES and ATOM records:

>d2jpoa1 a.39.2.1 (A:1-142) Moth pheromone-binding protein, PBP {Polyphemus moth (Antheraea polyphemus) [TaxId: 7120]}
speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld
vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk
eihklnwvpnmdlvigevlaev

Timeline for d2jpoa1:

• d2jpoa1 is new in SCOP 1.75
  
• d2jpoa1 appears in SCOPe 2.01
  
• d2jpoa1 appears in the current release, SCOPe 2.08, called d2jpoa_