SCOPe 2.08: Domain d2jpoa_: 2jpo A:

Lineage for d2jpoa_ (2jpo A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Moth pheromone-binding protein, PBP [47569] (2 species)

7. Species Polyphemus moth (Antheraea polyphemus) [TaxId:7120] [101187] (3 PDB entries)

8. Domain d2jpoa_: 2jpo A: [148166]
   automated match to d2jpoa1

Details for d2jpoa_

PDB Entry: 2jpo

PDB Description: NMR structure of Antheraea polyphemus pheromone-binding protein 1 at pH 4.5

PDB Compounds: (A:) pheromone-binding protein

SCOPe Domain Sequences for d2jpoa_:

Sequence; same for both SEQRES and ATOM records:

>d2jpoa_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Polyphemus moth (Antheraea polyphemus) [TaxId: 7120]}
speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld
vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk
eihklnwvpnmdlvigevlaev

Timeline for d2jpoa_:

• d2jpoa_ first appeared in SCOP 1.75, called d2jpoa1
  
• d2jpoa_ appears in SCOPe 2.07