Lineage for d2jpda_ (2jpd A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490490Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins)
  6. 2490491Protein DNA excision repair protein ERCC-1 [142445] (1 species)
  7. 2490492Species Human (Homo sapiens) [TaxId:9606] [142446] (3 PDB entries)
    Uniprot P07992 99-227
  8. 2490494Domain d2jpda_: 2jpd A: [148165]
    automated match to d2a1ia1

Details for d2jpda_

PDB Entry: 2jpd (more details)

PDB Description: solution structure of the ercc1 central domain
PDB Compounds: (A:) DNA excision repair protein ERCC-1

SCOPe Domain Sequences for d2jpda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jpda_ c.52.1.20 (A:) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]}
aksnsiivsprqrgnpvlkfvrnvpwefgdvipdyvlgqstcalflslryhnlhpdyihg
rlqslgknfalrvllvqvdvkdpqqalkelakmciladctlilawspeeagryletykay
eqkp

SCOPe Domain Coordinates for d2jpda_:

Click to download the PDB-style file with coordinates for d2jpda_.
(The format of our PDB-style files is described here.)

Timeline for d2jpda_: