SCOP 1.75: Domain d2jpda1: 2jpd A:99-219

Lineage for d2jpda1 (2jpd A:99-219)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (33 families)

5. Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins)

6. Protein DNA excision repair protein ERCC-1 [142445] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142446] (3 PDB entries)
   Uniprot P07992 99-227

8. Domain d2jpda1: 2jpd A:99-219 [148165]
   automatically matched to d2a1ia1

Details for d2jpda1

PDB Entry: 2jpd

PDB Description: solution structure of the ercc1 central domain

PDB Compounds: (A:) DNA excision repair protein ERCC-1

SCOP Domain Sequences for d2jpda1:

Sequence; same for both SEQRES and ATOM records:

>d2jpda1 c.52.1.20 (A:99-219) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]}
nsiivsprqrgnpvlkfvrnvpwefgdvipdyvlgqstcalflslryhnlhpdyihgrlq
slgknfalrvllvqvdvkdpqqalkelakmciladctlilawspeeagryletykayeqk
p

Timeline for d2jpda1:

• d2jpda1 is new in SCOP 1.75
  
• d2jpda1 appears in SCOPe 2.01
  
• d2jpda1 appears in the current release, SCOPe 2.08, called d2jpda_