SCOPe 2.08: Domain d2joza1: 2joz A:2-127

Lineage for d2joza1 (2joz A:2-127)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Hypothetical protein YxeF [159228] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [159229] (1 PDB entry)
   Uniprot P54945 19-144

8. Domain d2joza1: 2joz A:2-127 [148164]
   Other proteins in same PDB: d2joza2

Details for d2joza1

PDB Entry: 2joz

PDB Description: solution nmr structure of protein yxef, northeast structural genomics consortium target sr500a

PDB Compounds: (A:) Hypothetical protein yxeF

SCOPe Domain Sequences for d2joza1:

Sequence; same for both SEQRES and ATOM records:

>d2joza1 b.60.1.1 (A:2-127) Hypothetical protein YxeF {Bacillus subtilis [TaxId: 1423]}
imvsgcqqqkeetpfyygtwdegrapgptdgvksatvtftedevvetevmegrgevqlpf
maykvisqstdgsieiqylgpyyplkstlkrgengtliweqngqrktmtriesktgreek
deksks

Timeline for d2joza1:

• d2joza1 first appeared in SCOP 1.75
  
• d2joza1 appears in SCOPe 2.07