![]() | Class j: Peptides [58231] (133 folds) |
![]() | Fold j.35: Transmembrane helical fragments [58517] (1 superfamily) |
![]() | Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) ![]() |
![]() | Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins) the member of this family may be not related |
![]() | Protein Surfactant Protein B (SP-B) miniprotein constructs [58528] (1 species) |
![]() | Species Synthetic, based on Homo sapiens sequence [58529] (7 PDB entries) Uniprot P07988 208-225,263-278 |
![]() | Domain d2joua1: 2jou A:1-34 [148161] |
PDB Entry: 2jou (more details)
SCOPe Domain Sequences for d2joua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2joua1 j.35.1.1 (A:1-34) Surfactant Protein B (SP-B) miniprotein constructs {Synthetic, based on Homo sapiens sequence} cwlcralikriqamipkggrmlpqlvcrlvlrcs
Timeline for d2joua1: