Lineage for d2joua1 (2jou A:1-34)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046491Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 3046492Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 3046493Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 3046626Protein Surfactant Protein B (SP-B) miniprotein constructs [58528] (1 species)
  7. 3046627Species Synthetic, based on Homo sapiens sequence [58529] (7 PDB entries)
    Uniprot P07988 208-225,263-278
  8. 3046632Domain d2joua1: 2jou A:1-34 [148161]

Details for d2joua1

PDB Entry: 2jou (more details)

PDB Description: nmr structure of mini-b, an n-terminal- c-terminal construct from human surfactant protein-b (sp-b), in hexafluoroisopropanol (hfip)
PDB Compounds: (A:) Pulmonary surfactant-associated protein B

SCOPe Domain Sequences for d2joua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2joua1 j.35.1.1 (A:1-34) Surfactant Protein B (SP-B) miniprotein constructs {Synthetic, based on Homo sapiens sequence}
cwlcralikriqamipkggrmlpqlvcrlvlrcs

SCOPe Domain Coordinates for d2joua1:

Click to download the PDB-style file with coordinates for d2joua1.
(The format of our PDB-style files is described here.)

Timeline for d2joua1: