Lineage for d2joka1 (2jok A:78-261)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779632Fold a.168: SopE-like GEF domain [81831] (1 superfamily)
    multihelical; consists of two all-alpha subdomains each containing a 3-helical bundle with right-handed twist
  4. 779633Superfamily a.168.1: SopE-like GEF domain [81832] (1 family) (S)
  5. 779634Family a.168.1.1: SopE-like GEF domain [81833] (3 proteins)
    C-terminal part of Pfam PF05364
  6. 779635Protein Effector protein BopE [158691] (1 species)
  7. 779636Species Burkholderia pseudomallei [TaxId:28450] [158692] (2 PDB entries)
    Uniprot Q63K41 78-261
  8. 779637Domain d2joka1: 2jok A:78-261 [148158]
    automatically matched to 2JOL A:78-261

Details for d2joka1

PDB Entry: 2jok (more details)

PDB Description: nmr structure of the catalytic domain of guanine nucleotide exchange factor bope from burkholderia pseudomallei
PDB Compounds: (A:) Putative G-nucleotide exchange factor

SCOP Domain Sequences for d2joka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2joka1 a.168.1.1 (A:78-261) Effector protein BopE {Burkholderia pseudomallei [TaxId: 28450]}
tgdakqairhfvdeavkqvahartpeirqdaefgrqvyeatlcaifseakdrfcmdpatr
agnvrpafiealgdaaratglpgadkqgvftpsgagtnplyteirlradtlmgaelaarp
eyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaqdasrdekgatna
adga

SCOP Domain Coordinates for d2joka1:

Click to download the PDB-style file with coordinates for d2joka1.
(The format of our PDB-style files is described here.)

Timeline for d2joka1: