Lineage for d2joka_ (2jok A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735783Fold a.168: SopE-like GEF domain [81831] (1 superfamily)
    multihelical; consists of two all-alpha subdomains each containing a 3-helical bundle with right-handed twist
  4. 2735784Superfamily a.168.1: SopE-like GEF domain [81832] (1 family) (S)
  5. 2735785Family a.168.1.1: SopE-like GEF domain [81833] (3 proteins)
    C-terminal part of Pfam PF05364
  6. 2735786Protein Effector protein BopE [158691] (1 species)
  7. 2735787Species Burkholderia pseudomallei [TaxId:28450] [158692] (3 PDB entries)
    Uniprot Q63K41 78-261
  8. 2735789Domain d2joka_: 2jok A: [148158]
    automated match to d2jola1

Details for d2joka_

PDB Entry: 2jok (more details)

PDB Description: nmr structure of the catalytic domain of guanine nucleotide exchange factor bope from burkholderia pseudomallei
PDB Compounds: (A:) Putative G-nucleotide exchange factor

SCOPe Domain Sequences for d2joka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2joka_ a.168.1.1 (A:) Effector protein BopE {Burkholderia pseudomallei [TaxId: 28450]}
tgdakqairhfvdeavkqvahartpeirqdaefgrqvyeatlcaifseakdrfcmdpatr
agnvrpafiealgdaaratglpgadkqgvftpsgagtnplyteirlradtlmgaelaarp
eyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaqdasrdekgatna
adga

SCOPe Domain Coordinates for d2joka_:

Click to download the PDB-style file with coordinates for d2joka_.
(The format of our PDB-style files is described here.)

Timeline for d2joka_: