Lineage for d2joea1 (2joe A:2-131)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011714Fold d.371: YehR-like [160703] (1 superfamily)
    beta(3)-alpha-beta(2)-alpha(3)-beta; 2 layers, a/b; antiparallel beta-sheet, order: 612354
  4. 3011715Superfamily d.371.1: YehR-like [160704] (1 family) (S)
    automatically mapped to Pfam PF06998
  5. 3011716Family d.371.1.1: YehR-like [160705] (1 protein)
    Pfam PF06998; DUF1307
  6. 3011717Protein Hypothetical lipoprotein YehR [160706] (1 species)
  7. 3011718Species Escherichia coli [TaxId:562] [160707] (1 PDB entry)
    Uniprot P33354 24-153
  8. 3011719Domain d2joea1: 2joe A:2-131 [148157]
    Other proteins in same PDB: d2joea2, d2joea3

Details for d2joea1

PDB Entry: 2joe (more details)

PDB Description: nmr structure of e. coli yehr protein. northeast structural genomics target er538.
PDB Compounds: (A:) Hypothetical lipoprotein yehR

SCOPe Domain Sequences for d2joea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2joea1 d.371.1.1 (A:2-131) Hypothetical lipoprotein YehR {Escherichia coli [TaxId: 562]}
gdkeeskkfsanlngteiaityvykgdkvlkqssetkiqfasigattkedaaktleplsa
kykniagveekltytdtyaqenvtidmekvdfkalqgisginvsaedakkgitmaqmelv
mkaagfkevk

SCOPe Domain Coordinates for d2joea1:

Click to download the PDB-style file with coordinates for d2joea1.
(The format of our PDB-style files is described here.)

Timeline for d2joea1: