Lineage for d2jodb1 (2jod B:6-38)

  1. Root: SCOPe 2.03
  2. 1470528Class j: Peptides [58231] (120 folds)
  3. 1470747Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 1470748Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 1470749Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 1470840Protein Pituitary adenylate cyclase-activating polypeptide, PACAP [161291] (1 species)
  7. 1470841Species Human (Homo sapiens) [TaxId:9606] [161292] (1 PDB entry)
    Uniprot P18509 137-169
  8. 1470842Domain d2jodb1: 2jod B:6-38 [148156]
    Other proteins in same PDB: d2joda1

Details for d2jodb1

PDB Entry: 2jod (more details)

PDB Description: pac1-rshort n-terminal ec domain pacap(6-38) complex
PDB Compounds: (B:) Pituitary adenylate cyclase-activating polypeptide

SCOPe Domain Sequences for d2jodb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jodb1 j.6.1.1 (B:6-38) Pituitary adenylate cyclase-activating polypeptide, PACAP {Human (Homo sapiens) [TaxId: 9606]}
ftdsysryrkqmavkkylaavlgkrykqrvknk

SCOPe Domain Coordinates for d2jodb1:

Click to download the PDB-style file with coordinates for d2jodb1.
(The format of our PDB-style files is described here.)

Timeline for d2jodb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2joda1