SCOP 1.75: Domain d2jnya1: 2jny A:1-59

Lineage for d2jnya1 (2jny A:1-59)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.171: Trm112p-like [158996] (1 superfamily)
   similar to the small domain of the ISP ((50021))
   similar to the small domain of the ISP ((50021))

4. Superfamily b.171.1: Trm112p-like [158997] (1 family)
   possibly have evolved from a metal ion (or cofactor)-binding protein of a rubredoxin-like fold; in the known members, from one to three of the four metal-binding positions are occupied by cysteine residues

5. Family b.171.1.1: Trm112p-like [158998] (3 proteins)
   Pfam PF03966; previously DUF343

6. Protein Uncharacterized protein Cgl1405/cg1592 [158999] (1 species)

7. Species Corynebacterium glutamicum [TaxId:1718] [159000] (1 PDB entry)
   Uniprot Q8NQM9 1-59

8. Domain d2jnya1: 2jny A:1-59 [148153]

Details for d2jnya1

PDB Entry: 2jny

PDB Description: solution nmr structure of protein uncharacterized bcr, northeast structural genomics consortium target cgr1

PDB Compounds: (A:) Uncharacterized BCR

SCOP Domain Sequences for d2jnya1:

Sequence; same for both SEQRES and ATOM records:

>d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]}
msldpqllevlacpkdkgplryleseqllvnerlnlayriddgipvllideatewtpnn

Timeline for d2jnya1:

• d2jnya1 is new in SCOP 1.75
  
• d2jnya1 appears in SCOPe 2.01
  
• d2jnya1 appears in the current release, SCOPe 2.08