SCOPe 2.08: Domain d2jnga1: 2jng A:5-80

Lineage for d2jnga1 (2jng A:5-80)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.4: CPH domain [159021] (2 proteins)
   automatically mapped to Pfam PF11515

6. Protein Cullin-7 [159022] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159023] (1 PDB entry)
   Uniprot Q14999 360-435

8. Domain d2jnga1: 2jng A:5-80 [148150]
   Other proteins in same PDB: d2jnga2

Details for d2jnga1

PDB Entry: 2jng

PDB Description: solution structure of the cul7-cph domain from homo sapiens; northeast structural genomics consortium target ht1.

PDB Compounds: (A:) Cullin-7

SCOPe Domain Sequences for d2jnga1:

Sequence; same for both SEQRES and ATOM records:

>d2jnga1 b.34.9.4 (A:5-80) Cullin-7 {Human (Homo sapiens) [TaxId: 9606]}
rsefasgntyalyvrdtlqpgmrvrmlddyeeisagdegefrqsnngvppvqvfwestgr
tywvhwhmleilgfee

Timeline for d2jnga1:

• d2jnga1 first appeared in SCOP 1.75
  
• d2jnga1 appears in SCOPe 2.07