Lineage for d2jnea1 (2jne A:1-71)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2642126Superfamily g.41.18: YfgJ-like [161187] (1 family) (S)
    duplication: consists of two rubredoxin-like (sub)domains, interlocked together
    automatically mapped to Pfam PF07191
  5. 2642127Family g.41.18.1: YfgJ-like [161188] (1 protein)
    Pfam PF07191, DUF1407
  6. 2642128Protein Hypothetical protein YfgJ [161189] (1 species)
  7. 2642129Species Escherichia coli [TaxId:562] [161190] (1 PDB entry)
    Uniprot P76575 13-83
  8. 2642130Domain d2jnea1: 2jne A:1-71 [148149]
    complexed with zn

Details for d2jnea1

PDB Entry: 2jne (more details)

PDB Description: nmr structure of e.coli yfgj modelled with two zn+2 bound. northeast structural genomics consortium target er317.
PDB Compounds: (A:) Hypothetical protein yfgJ

SCOPe Domain Sequences for d2jnea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]}
melhcpqcqhvldqdngharcrscgefiemkalcpdchqplqvlkacgavdyfcqhghgl
iskkrvefvla

SCOPe Domain Coordinates for d2jnea1:

Click to download the PDB-style file with coordinates for d2jnea1.
(The format of our PDB-style files is described here.)

Timeline for d2jnea1: