SCOPe 2.06: Domain d2jnea1: 2jne A:1-71

Lineage for d2jnea1 (2jne A:1-71)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.18: YfgJ-like [161187] (1 family)
   duplication: consists of two rubredoxin-like (sub)domains, interlocked together
   automatically mapped to Pfam PF07191

5. Family g.41.18.1: YfgJ-like [161188] (1 protein)
   Pfam PF07191, DUF1407

6. Protein Hypothetical protein YfgJ [161189] (1 species)

7. Species Escherichia coli [TaxId:562] [161190] (1 PDB entry)
   Uniprot P76575 13-83

8. Domain d2jnea1: 2jne A:1-71 [148149]
   complexed with zn

Details for d2jnea1

PDB Entry: 2jne

PDB Description: nmr structure of e.coli yfgj modelled with two zn+2 bound. northeast structural genomics consortium target er317.

PDB Compounds: (A:) Hypothetical protein yfgJ

SCOPe Domain Sequences for d2jnea1:

Sequence; same for both SEQRES and ATOM records:

>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]}
melhcpqcqhvldqdngharcrscgefiemkalcpdchqplqvlkacgavdyfcqhghgl
iskkrvefvla

Timeline for d2jnea1:

• d2jnea1 first appeared in SCOP 1.75
  
• d2jnea1 appears in SCOPe 2.05
  
• d2jnea1 appears in SCOPe 2.07
  
• d2jnea1 appears in the current release, SCOPe 2.08