Class g: Small proteins [56992] (94 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.18: YfgJ-like [161187] (1 family) duplication: consists of two rubredoxin-like (sub)domains, interlocked together automatically mapped to Pfam PF07191 |
Family g.41.18.1: YfgJ-like [161188] (1 protein) Pfam PF07191, DUF1407 |
Protein Hypothetical protein YfgJ [161189] (1 species) |
Species Escherichia coli [TaxId:562] [161190] (1 PDB entry) Uniprot P76575 13-83 |
Domain d2jnea1: 2jne A:1-71 [148149] complexed with zn |
PDB Entry: 2jne (more details)
SCOPe Domain Sequences for d2jnea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} melhcpqcqhvldqdngharcrscgefiemkalcpdchqplqvlkacgavdyfcqhghgl iskkrvefvla
Timeline for d2jnea1: