Lineage for d2jn9a1 (2jn9 A:3-97)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387119Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2387470Superfamily b.45.3: YkvR-like [159173] (1 family) (S)
    provisional classification, pending better resolution structures
    automatically mapped to Pfam PF11514
  5. 2387471Family b.45.3.1: YkvR-like [159174] (1 protein)
    PfamB PB102647
  6. 2387472Protein Uncharacterized protein YkvR [159175] (1 species)
  7. 2387473Species Bacillus subtilis [TaxId:1423] [159176] (1 PDB entry)
    Uniprot O31683 1-96
  8. 2387474Domain d2jn9a1: 2jn9 A:3-97 [148145]
    Other proteins in same PDB: d2jn9a2, d2jn9a3

Details for d2jn9a1

PDB Entry: 2jn9 (more details)

PDB Description: NMR solution structure of YkvR protein from Bacillus subtilis: NESG target SR358
PDB Compounds: (A:) YkvR protein

SCOPe Domain Sequences for d2jn9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jn9a1 b.45.3.1 (A:3-97) Uncharacterized protein YkvR {Bacillus subtilis [TaxId: 1423]}
ktlrlnnvtlemaayqeesepkrkiaftlnvtsetyhdiavllyektfnvevperdlafr
gemtnystsltnlyepgavsefyieiteidknads

SCOPe Domain Coordinates for d2jn9a1:

Click to download the PDB-style file with coordinates for d2jn9a1.
(The format of our PDB-style files is described here.)

Timeline for d2jn9a1: